PTM Viewer PTM Viewer

AT2G36320.1

Arabidopsis thaliana [ath]

A20/AN1-like zinc finger family protein

No PTMs currently found

PLAZA: AT2G36320
Gene Family: HOM05D000357
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 161

MAEEHRCETPEGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTEQPSPPQRPNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAKLQKI

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000058 96 142
IPR002653 10 44
Sites
Show Type Position
Active Site 16
Active Site 20
Active Site 32
Active Site 35
Active Site 102
Active Site 105
Active Site 123
Active Site 126
Active Site 116
Active Site 118
Active Site 132
Active Site 134

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here